PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00097946001
Common NameGSBRNA2T00097946001, LOC106444825, LOC106444826
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 285aa    MW: 31799.2 Da    PI: 8.5627
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00097946001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.38e-393392261
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                          +++lkcprC+s+ntkfCyynny+lsqPr+fCk+CrryWt+GGalrnvP+Ggg+rk kks
  GSBRNA2T00097946001 33 DQQTLKCPRCNSSNTKFCYYNNYNLSQPRHFCKSCRRYWTRGGALRNVPIGGGCRKTKKS 92
                         57899***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-312091IPR003851Zinc finger, Dof-type
PfamPF027014.6E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.7113791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MSSHTNLHSP KPDHGISGTS HTKKLPSSSS SQDQQTLKCP RCNSSNTKFC YYNNYNLSQP  60
RHFCKSCRRY WTRGGALRNV PIGGGCRKTK KSFKPNTSTP SCQRFYSSVM EDSSKFFPPP  120
TTMGFQLMNN QEVLGLRPME QAETTPVDVR SGLSLMGFGD YSNHSPATFS TAGTLATSIE  180
TLSCLNQDLH WRLQQQRMAM LFGNSNEETV VVERPQPILN RNLEIVNSPP TKKGENQTEW  240
YFGNNNDNEG VVSNNDNNNN TGGSDQWNNG IQAWTDLNHY NALP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892660.0AC189266.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB022L12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013741707.10.0PREDICTED: dof zinc finger protein DOF5.7-like
RefseqXP_013741708.10.0PREDICTED: dof zinc finger protein DOF5.7-like
SwissprotQ9LSL61e-155DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLA0A078JXH40.0A0A078JXH4_BRANA; BnaAnng33280D protein
STRINGBra037822.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49502850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-140Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]